PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG138300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 472aa    MW: 50639.2 Da    PI: 4.2012
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG138300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF435.7e-141251342
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                         i  ks rq +f kRr +++ KA  LS+LC++ +avi+++s
  Pavir.3KG138300.1.p 12 IVQKSERQASFRKRRGTLFDKARDLSILCQVPAAVIVYGS 51
                         56799*********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.2E-14161IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-6424IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-17590IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.661551IPR002100Transcription factor, MADS-box
CDDcd002663.20E-18686No hitNo description
PfamPF003191.9E-121451IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-62439IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-63960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MPRAGKVKIQ WIVQKSERQA SFRKRRGTLF DKARDLSILC QVPAAVIVYG SGEAQPQVWP  60
GIQEVTGILQ RYRDLPDSLK EARRLDNELF MRRRTEKMRR KLDNCRASAS RLEVNLILND  120
ISLGRRREFA DLPRELTGAV VSGLDALRSV TADRVNFLRS EAAQAAALPQ QQLEEAVAAA  180
LMALQESRSP MVPPVAMAPP MVANAQPAPP QSALVPPPPP PQLLQEEPPM VPPLAMAPVV  240
AGAPLLLPAP EPEPPVVPPL SMAPMVADAP LLLPAPEPPM MPPLAMAPVL FDDAPLDLLL  300
LLLPDPEPLP PQSELVVAPA PPLQEPPMVA EAEAQLLLPA PLPEPPMMPP LAMAPVDDVP  360
IDLLLLLLPD PEPVPPPPQS ELVVAPAPAL QEPPMVADAP LLLPAAEPEP PAAAAGAVVD  420
EPLDLYAEPR DGSFLLEMAD AIMDDGSGRQ ATSEDVDRLL REYGLESFKP M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440555.12e-55hypothetical protein SORBIDRAFT_09g003030
TrEMBLK3ZDZ11e-150K3ZDZ1_SETIT; Uncharacterized protein
STRINGSi024783m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2104367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.14e-15AGAMOUS-like 48